Lineage for d1yaut_ (1yau T:)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1726514Fold a.24: Four-helical up-and-down bundle [47161] (28 superfamilies)
    core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down
  4. 1726906Superfamily a.24.8: Proteasome activator [47216] (1 family) (S)
  5. 1726907Family a.24.8.1: Proteasome activator [47217] (3 proteins)
  6. 1726920Protein automated matches [190828] (1 species)
    not a true protein
  7. 1726921Species Trypanosome (Trypanosoma brucei) [TaxId:5691] [188131] (5 PDB entries)
  8. 1726940Domain d1yaut_: 1yau T: [144627]
    Other proteins in same PDB: d1yaua_, d1yaub_, d1yauc_, d1yaud_, d1yaue_, d1yauf_, d1yaug_, d1yauh_, d1yaui_, d1yauj_, d1yauk_, d1yaul_, d1yaum_, d1yaun_
    automated match to d1ya7o1
    complexed with gol, so4

Details for d1yaut_

PDB Entry: 1yau (more details), 2.4 Å

PDB Description: structure of archeabacterial 20s proteasome- pa26 complex
PDB Compounds: (T:) proteasome activator protein PA26

SCOPe Domain Sequences for d1yaut_:

Sequence, based on SEQRES records: (download)

>d1yaut_ a.24.8.1 (T:) automated matches {Trypanosome (Trypanosoma brucei) [TaxId: 5691]}
kraaliqnlrdsytetssfavieewaagtlqeiegiakaaaeahgvirnstygraqaeks
peqllgvlqryqdlchnvycqaetirtviairipehkeednlgvavqhavlkiideleik
tlgsgeksgsggaptpigmyalreylsarstvedkllgsvdaesgktkggsqspslllel
rqidadfmlkvelatthlstmvravinayllnwkkliqprtgsdhmvs

Sequence, based on observed residues (ATOM records): (download)

>d1yaut_ a.24.8.1 (T:) automated matches {Trypanosome (Trypanosoma brucei) [TaxId: 5691]}
kraaliqnlrdsytetssfavieewaagtlqeiegiakaaaeahgvirnstygraqaeks
peqllgvlqryqdlchnvycqaetirtviairipehkeednlgvavqhavlkiideleik
tlgsgeksgsggaptpigmyalreylsarstvedkllgggsqspslllelrqidadfmlk
velatthlstmvravinayllnwkkliqprtgsdhmvs

SCOPe Domain Coordinates for d1yaut_:

Click to download the PDB-style file with coordinates for d1yaut_.
(The format of our PDB-style files is described here.)

Timeline for d1yaut_: