Lineage for d1yaut1 (1yau T:4-231)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 765368Fold a.24: Four-helical up-and-down bundle [47161] (28 superfamilies)
    core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down
  4. 765527Superfamily a.24.8: Proteasome activator [47216] (1 family) (S)
  5. 765528Family a.24.8.1: Proteasome activator [47217] (2 proteins)
  6. 765529Protein Proteasome activator protein PA26 [158392] (1 species)
  7. 765530Species Trypanosoma brucei [TaxId:5691] [158393] (3 PDB entries)
    Uniprot Q9U8G2 4-231
  8. 765550Domain d1yaut1: 1yau T:4-231 [144627]
    Other proteins in same PDB: d1yaua1, d1yaub1, d1yauc1, d1yaud1, d1yaue1, d1yauf1, d1yaug1, d1yauh1, d1yaui1, d1yauj1, d1yauk1, d1yaul1, d1yaum1, d1yaun1
    automatically matched to 1YA7 O:4-231
    complexed with gol, so4; mutant

Details for d1yaut1

PDB Entry: 1yau (more details), 2.4 Å

PDB Description: structure of archeabacterial 20s proteasome- pa26 complex
PDB Compounds: (T:) proteasome activator protein PA26

SCOP Domain Sequences for d1yaut1:

Sequence, based on SEQRES records: (download)

>d1yaut1 a.24.8.1 (T:4-231) Proteasome activator protein PA26 {Trypanosoma brucei [TaxId: 5691]}
kraaliqnlrdsytetssfavieewaagtlqeiegiakaaaeahgvirnstygraqaeks
peqllgvlqryqdlchnvycqaetirtviairipehkeednlgvavqhavlkiideleik
tlgsgeksgsggaptpigmyalreylsarstvedkllgsvdaesgktkggsqspslllel
rqidadfmlkvelatthlstmvravinayllnwkkliqprtgsdhmvs

Sequence, based on observed residues (ATOM records): (download)

>d1yaut1 a.24.8.1 (T:4-231) Proteasome activator protein PA26 {Trypanosoma brucei [TaxId: 5691]}
kraaliqnlrdsytetssfavieewaagtlqeiegiakaaaeahgvirnstygraqaeks
peqllgvlqryqdlchnvycqaetirtviairipehkeednlgvavqhavlkiideleik
tlgsgeksgsggaptpigmyalreylsarstvedkllgggsqspslllelrqidadfmlk
velatthlstmvravinayllnwkkliqprtgsdhmvs

SCOP Domain Coordinates for d1yaut1:

Click to download the PDB-style file with coordinates for d1yaut1.
(The format of our PDB-style files is described here.)

Timeline for d1yaut1: