Lineage for d1y8na1 (1y8n A:13-176)

  1. Root: SCOPe 2.02
  2. 1074916Class a: All alpha proteins [46456] (284 folds)
  3. 1086488Fold a.29: Bromodomain-like [47363] (15 superfamilies)
    4 helices; bundle; minor mirror variant of up-and-down topology
  4. 1086724Superfamily a.29.5: alpha-ketoacid dehydrogenase kinase, N-terminal domain [69012] (1 family) (S)
  5. 1086725Family a.29.5.1: alpha-ketoacid dehydrogenase kinase, N-terminal domain [69013] (2 proteins)
  6. 1086731Protein Pyruvate dehydrogenase kinase [69016] (2 species)
  7. 1086732Species Human (Homo sapiens) [TaxId:9606] [158429] (5 PDB entries)
    Uniprot Q15120 13-176
  8. 1086740Domain d1y8na1: 1y8n A:13-176 [144601]
    Other proteins in same PDB: d1y8na2, d1y8nb1
    complexed with k, red

Details for d1y8na1

PDB Entry: 1y8n (more details), 2.6 Å

PDB Description: Crystal structure of the PDK3-L2 complex
PDB Compounds: (A:) [Pyruvate dehydrogenase [lipoamide]] kinase isozyme 3

SCOPe Domain Sequences for d1y8na1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1y8na1 a.29.5.1 (A:13-176) Pyruvate dehydrogenase kinase {Human (Homo sapiens) [TaxId: 9606]}
pkqierysrfspsplsikqfldfgrdnacektsymflrkelpvrlantmrevnllpdnll
nrpsvglvqswymqsflelleyenkspedpqvldnflqvlikvrnrhndvvptmaqgvie
ykekfgfdpfistniqyfldrfytnrisfrmlinqhtllfggdt

SCOPe Domain Coordinates for d1y8na1:

Click to download the PDB-style file with coordinates for d1y8na1.
(The format of our PDB-style files is described here.)

Timeline for d1y8na1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1y8na2
View in 3D
Domains from other chains:
(mouse over for more information)
d1y8nb1