![]() | Class a: All alpha proteins [46456] (284 folds) |
![]() | Fold a.26: 4-helical cytokines [47265] (1 superfamily) core: 4 helices; bundle, closed; left-handed twist; 2 crossover connections |
![]() | Superfamily a.26.1: 4-helical cytokines [47266] (3 families) ![]() there are two different topoisomers of this fold with different entanglements of the two crossover connections |
![]() | Family a.26.1.3: Interferons/interleukin-10 (IL-10) [47305] (8 proteins) contains an additional helix in one of the crossover connections |
![]() | Protein Interleukin-10 (cytokine synthesis inhibitory factor, CSIF) [47306] (3 species) intertwined dimer, similar to interferon-gamma |
![]() | Species Epstein-Barr virus [TaxId:10376] [47308] (3 PDB entries) |
![]() | Domain d1y6nl1: 1y6n L:12-157 [144600] Other proteins in same PDB: d1y6nr1, d1y6nr2 mutant |
PDB Entry: 1y6n (more details), 2.7 Å
SCOP Domain Sequences for d1y6nl1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1y6nl1 a.26.1.3 (L:12-157) Interleukin-10 (cytokine synthesis inhibitory factor, CSIF) {Epstein-Barr virus [TaxId: 10376]} cdnfpqmlrdlrdafsrvktffqtkdevdnlllkeslledfkgylgcqalsemiqfylee vmpqaenqdpeikdhvnslgenlktlrlrlrrchrflpcenkskaveqiknafnklqekg iykamsefdifinyieaymtik
Timeline for d1y6nl1: