SCOPe 2.08: Domain d1y6nl1: 1y6n L:12-157

Lineage for d1y6nl1 (1y6n L:12-157)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.26: 4-helical cytokines [47265] (1 superfamily)
   core: 4 helices; bundle, closed; left-handed twist; 2 crossover connections

4. Superfamily a.26.1: 4-helical cytokines [47266] (4 families)
   there are two different topoisomers of this fold with different entanglements of the two crossover connections

5. Family a.26.1.3: Interferons/interleukin-10 (IL-10) [47305] (9 proteins)
   contains an additional helix in one of the crossover connections

6. Protein Interleukin-10 (cytokine synthesis inhibitory factor, CSIF) [47306] (3 species)
   intertwined dimer, similar to interferon-gamma

7. Species Epstein-Barr virus [TaxId:10376] [47308] (3 PDB entries)

8. Domain d1y6nl1: 1y6n L:12-157 [144600]
   Other proteins in same PDB: d1y6nr1, d1y6nr2
   mutant

Details for d1y6nl1

PDB Entry: 1y6n, 2.7 Å

PDB Description: crystal structure of epstein-barr virus il-10 mutant (a87i) complexed with the soluble il-10r1 chain

PDB Compounds: (L:) Viral interleukin-10 homolog

SCOPe Domain Sequences for d1y6nl1:

Sequence; same for both SEQRES and ATOM records:

>d1y6nl1 a.26.1.3 (L:12-157) Interleukin-10 (cytokine synthesis inhibitory factor, CSIF) {Epstein-Barr virus [TaxId: 10376]}
cdnfpqmlrdlrdafsrvktffqtkdevdnlllkeslledfkgylgcqalsemiqfylee
vmpqaenqdpeikdhvnslgenlktlrlrlrrchrflpcenkskaveqiknafnklqekg
iykamsefdifinyieaymtik

Timeline for d1y6nl1:

• d1y6nl1 first appeared in SCOP 1.75
  
• d1y6nl1 appears in SCOPe 2.07