![]() | Class f: Membrane and cell surface proteins and peptides [56835] (60 folds) |
![]() | Fold f.21: Heme-binding four-helical bundle [81344] (3 superfamilies) core: four transmembrane helices, up-and-down bundle, binds one or two heme groups in between the helices |
![]() | Superfamily f.21.3: Respiratory nitrate reductase 1 gamma chain [103501] (1 family) ![]() possible link between the two other superfamilies: this subunit corresponds to the gamma subunit of a functionally related Formate dehydrogenase N complex but is structurally closer to the Fumarate reductase subunit FrdC automatically mapped to Pfam PF02665 |
![]() | Family f.21.3.1: Respiratory nitrate reductase 1 gamma chain [103502] (2 proteins) |
![]() | Protein Respiratory nitrate reductase 1 gamma chain [103503] (1 species) |
![]() | Species Escherichia coli [TaxId:562] [103504] (6 PDB entries) Uniprot P11350 |
![]() | Domain d1y5nc_: 1y5n C: [144599] Other proteins in same PDB: d1y5na1, d1y5na2, d1y5nb_ automated match to d1q16c_ complexed with 3ph, 6mo, aga, f3s, hem, md1, pci, sf4; mutant |
PDB Entry: 1y5n (more details), 2.5 Å
SCOPe Domain Sequences for d1y5nc_:
Sequence, based on SEQRES records: (download)
>d1y5nc_ f.21.3.1 (C:) Respiratory nitrate reductase 1 gamma chain {Escherichia coli [TaxId: 562]} mqflnmfffdiypyiagavfligswlrydygqytwraassqmldrkgmnlasnlfhigil gifvghffgmltphwmyeawlpievaqkmamfaggasgvlcliggvlllkrrlfsprvra tttgadililsllviqcalglltipfsaqhmdgsemmklvgwaqsvvtfhggasqhldgv afifrlhlvlgmtlfllfpfsrlihiwsvpveyltrkyqlvrarh
>d1y5nc_ f.21.3.1 (C:) Respiratory nitrate reductase 1 gamma chain {Escherichia coli [TaxId: 562]} mqflnmfffdiypyiagavfligswlrydygqytwraassqmldrkgmnlasnlfhigil gifvghffgmltlpievaqkmamfaggasgvlcliggvlllkrrlfsprvratttgadil ilsllviqcalglltipfsaqhmdgsemmklvgwaqsvvtfhggasqhldgvafifrlhl vlgmtlfllfpfsrlihiwsvpveyltrkyqlvrarh
Timeline for d1y5nc_: