SCOPe 2.08: Domain d1y5nc_: 1y5n C:

Lineage for d1y5nc_ (1y5n C:)

1. Root: SCOPe 2.08

2. Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)

3. Fold f.21: Heme-binding four-helical bundle [81344] (3 superfamilies)
   core: four transmembrane helices, up-and-down bundle, binds one or two heme groups in between the helices

4. Superfamily f.21.3: Respiratory nitrate reductase 1 gamma chain [103501] (1 family)
   possible link between the two other superfamilies: this subunit corresponds to the gamma subunit of a functionally related Formate dehydrogenase N complex but is structurally closer to the Fumarate reductase subunit FrdC
   automatically mapped to Pfam PF02665

5. Family f.21.3.1: Respiratory nitrate reductase 1 gamma chain [103502] (2 proteins)

6. Protein Respiratory nitrate reductase 1 gamma chain [103503] (1 species)

7. Species Escherichia coli [TaxId:562] [103504] (6 PDB entries)
   Uniprot P11350

8. Domain d1y5nc_: 1y5n C: [144599]
   Other proteins in same PDB: d1y5na1, d1y5na2, d1y5nb_
   automated match to d1q16c_
   complexed with 3ph, 6mo, aga, f3s, hem, md1, pci, sf4; mutant

Details for d1y5nc_

PDB Entry: 1y5n, 2.5 Å

PDB Description: the crystal structure of the narghi mutant nari-k86a in complex with pentachlorophenol

PDB Compounds: (C:) Respiratory nitrate reductase 1 gamma chain

SCOPe Domain Sequences for d1y5nc_:

Sequence, based on SEQRES records:

>d1y5nc_ f.21.3.1 (C:) Respiratory nitrate reductase 1 gamma chain {Escherichia coli [TaxId: 562]}
mqflnmfffdiypyiagavfligswlrydygqytwraassqmldrkgmnlasnlfhigil
gifvghffgmltphwmyeawlpievaqkmamfaggasgvlcliggvlllkrrlfsprvra
tttgadililsllviqcalglltipfsaqhmdgsemmklvgwaqsvvtfhggasqhldgv
afifrlhlvlgmtlfllfpfsrlihiwsvpveyltrkyqlvrarh

Sequence, based on observed residues (ATOM records):

>d1y5nc_ f.21.3.1 (C:) Respiratory nitrate reductase 1 gamma chain {Escherichia coli [TaxId: 562]}
mqflnmfffdiypyiagavfligswlrydygqytwraassqmldrkgmnlasnlfhigil
gifvghffgmltlpievaqkmamfaggasgvlcliggvlllkrrlfsprvratttgadil
ilsllviqcalglltipfsaqhmdgsemmklvgwaqsvvtfhggasqhldgvafifrlhl
vlgmtlfllfpfsrlihiwsvpveyltrkyqlvrarh

Timeline for d1y5nc_:

• d1y5nc_ first appeared in SCOP 1.75, called d1y5nc1
  
• d1y5nc_ appears in SCOPe 2.07