Lineage for d1y5ha3 (1y5h A:2-124)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2943253Fold d.37: CBS-domain pair [54630] (1 superfamily)
    duplication: tandem repeat of two beta-X-beta-alpha-beta(2)-alpha motifs of similar sequences; 4 layers: a/b/b/a
  4. 2943254Superfamily d.37.1: CBS-domain pair [54631] (2 families) (S)
  5. 2943255Family d.37.1.1: CBS-domain pair [54632] (21 proteins)
    Pfam PF00571; pairs of CBS domains dimerize to form a stable globular domain, a.k.a. Bateman domain
  6. 2943306Protein Hypothetical protein Rv2626c [143142] (1 species)
  7. 2943307Species Mycobacterium tuberculosis [TaxId:1773] [143143] (2 PDB entries)
    Uniprot O06186 2-124
  8. 2943308Domain d1y5ha3: 1y5h A:2-124 [144595]

Details for d1y5ha3

PDB Entry: 1y5h (more details), 1.5 Å

PDB Description: Crystal structure of truncated Se-Met Hypoxic Response Protein I (HRPI)
PDB Compounds: (A:) hypothetical protein RV2626C

SCOPe Domain Sequences for d1y5ha3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1y5ha3 d.37.1.1 (A:2-124) Hypothetical protein Rv2626c {Mycobacterium tuberculosis [TaxId: 1773]}
ttardimnagvtcvgehetltaaaqymrehdigalpicgdddrlhgmltdrdivikglaa
gldpntatagelardsiyyvdanasiqemlnvmeehqvrrvpvisehrlvgivteadiar
hlp

SCOPe Domain Coordinates for d1y5ha3:

Click to download the PDB-style file with coordinates for d1y5ha3.
(The format of our PDB-style files is described here.)

Timeline for d1y5ha3:

View in 3D
Domains from other chains:
(mouse over for more information)
d1y5hb3