Lineage for d1y4di_ (1y4d I:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1902783Fold d.40: CI-2 family of serine protease inhibitors [54653] (1 superfamily)
    alpha+beta sandwich; loop across free side of beta-sheet
  4. 1902784Superfamily d.40.1: CI-2 family of serine protease inhibitors [54654] (2 families) (S)
  5. 1902785Family d.40.1.1: CI-2 family of serine protease inhibitors [54655] (5 proteins)
    automatically mapped to Pfam PF00280
  6. 1902786Protein Chymotrypsin inhibitor CI-2 [54658] (1 species)
  7. 1902787Species Barley (Hordeum vulgare) [TaxId:4513] [54659] (29 PDB entries)
    Uniprot Q40059 22-84
  8. 1902811Domain d1y4di_: 1y4d I: [144593]
    Other proteins in same PDB: d1y4de_
    automated match to d1y4ai1
    complexed with ca, na; mutant

Details for d1y4di_

PDB Entry: 1y4d (more details), 2 Å

PDB Description: crystal structure of the complex of subtilisin bpn' with chymotrypsin inhibitor 2 m59r/e60s mutant
PDB Compounds: (I:) chymotrypsin inhibitor 2

SCOPe Domain Sequences for d1y4di_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1y4di_ d.40.1.1 (I:) Chymotrypsin inhibitor CI-2 {Barley (Hordeum vulgare) [TaxId: 4513]}
ktewpelvgksveeakkvilqdkpaaqiivlpvgtivtrsyridrvrlfvdrldniaqvp
rvg

SCOPe Domain Coordinates for d1y4di_:

Click to download the PDB-style file with coordinates for d1y4di_.
(The format of our PDB-style files is described here.)

Timeline for d1y4di_: