SCOP 1.75: Domain d1y4di1: 1y4d I:21-83

Lineage for d1y4di1 (1y4d I:21-83)

1. Root: SCOP 1.75

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.40: CI-2 family of serine protease inhibitors [54653] (1 superfamily)
   alpha+beta sandwich; loop across free side of beta-sheet

4. Superfamily d.40.1: CI-2 family of serine protease inhibitors [54654] (1 family)

5. Family d.40.1.1: CI-2 family of serine protease inhibitors [54655] (4 proteins)

6. Protein Chymotrypsin inhibitor CI-2 [54658] (1 species)

7. Species Barley (Hordeum vulgare) [TaxId:4513] [54659] (29 PDB entries)
   Uniprot Q40059 22-84

8. Domain d1y4di1: 1y4d I:21-83 [144593]
   Other proteins in same PDB: d1y4de1
   automatically matched to 1Y4A I:21-83
   complexed with ca, na; mutant

Details for d1y4di1

PDB Entry: 1y4d, 2 Å

PDB Description: crystal structure of the complex of subtilisin bpn' with chymotrypsin inhibitor 2 m59r/e60s mutant

PDB Compounds: (I:) chymotrypsin inhibitor 2

SCOP Domain Sequences for d1y4di1:

Sequence; same for both SEQRES and ATOM records:

>d1y4di1 d.40.1.1 (I:21-83) Chymotrypsin inhibitor CI-2 {Barley (Hordeum vulgare) [TaxId: 4513]}
ktewpelvgksveeakkvilqdkpaaqiivlpvgtivtrsyridrvrlfvdrldniaqvp
rvg

Timeline for d1y4di1:

• d1y4di1 is new in SCOP 1.75
  
• d1y4di1 is called d1y4di_ in SCOPe 2.01
  
• d1y4di1 appears in the current release, SCOPe 2.08, called d1y4di_