Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.40: CI-2 family of serine protease inhibitors [54653] (1 superfamily) alpha+beta sandwich; loop across free side of beta-sheet |
Superfamily d.40.1: CI-2 family of serine protease inhibitors [54654] (2 families) |
Family d.40.1.1: CI-2 family of serine protease inhibitors [54655] (5 proteins) automatically mapped to Pfam PF00280 |
Protein Chymotrypsin inhibitor CI-2 [54658] (1 species) |
Species Barley (Hordeum vulgare) [TaxId:4513] [54659] (29 PDB entries) Uniprot Q40059 22-84 |
Domain d1y4ai1: 1y4a I:21-83 [144592] Other proteins in same PDB: d1y4ae_ complexed with 15p, ca, cit, na; mutant |
PDB Entry: 1y4a (more details), 1.6 Å
SCOPe Domain Sequences for d1y4ai1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1y4ai1 d.40.1.1 (I:21-83) Chymotrypsin inhibitor CI-2 {Barley (Hordeum vulgare) [TaxId: 4513]} ktewpelvgksveeakkvilqdkpaaqiivlpvgtivtrsyridrvrlfvdrldniaqvp rvg
Timeline for d1y4ai1: