Lineage for d1y3di1 (1y3d I:21-83)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.40: CI-2 family of serine protease inhibitors [54653] (1 superfamily)
    alpha+beta sandwich; loop across free side of beta-sheet
  4. Superfamily d.40.1: CI-2 family of serine protease inhibitors [54654] (2 families) (S)
  5. Family d.40.1.1: CI-2 family of serine protease inhibitors [54655] (5 proteins)
    automatically mapped to Pfam PF00280
  6. Protein Chymotrypsin inhibitor CI-2 [54658] (1 species)
  7. Species Barley (Hordeum vulgare) [TaxId:4513] [54659] (29 PDB entries)
    Uniprot Q40059 22-84
  8. Domain d1y3di1: 1y3d I:21-83 [144589]
    Other proteins in same PDB: d1y3de2, d1y3de3
    complexed with 15p, ca, cit, na; mutant

Details for d1y3di1

PDB Entry: 1y3d (more details), 1.8 Å

PDB Description: crystal structure of the complex of subtilisin bpn' with chymotrypsin inhibitor 2 r67a mutant
PDB Compounds: (I:) chymotrypsin inhibitor 2

SCOPe Domain Sequences for d1y3di1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1y3di1 d.40.1.1 (I:21-83) Chymotrypsin inhibitor CI-2 {Barley (Hordeum vulgare) [TaxId: 4513]}
ktewpelvgksveeakkvilqdkpaaqiivlpvgtivtmeyridrvalfvdrldniaqvp
rvg

SCOPe Domain Coordinates for d1y3di1 are not available.

Timeline for d1y3di1:

View in 3D
Domains from other chains:
(mouse over for more information)
d1y3de2, d1y3de3