Lineage for d1y3ci1 (1y3c I:21-83)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 859036Fold d.40: CI-2 family of serine protease inhibitors [54653] (1 superfamily)
    alpha+beta sandwich; loop across free side of beta-sheet
  4. 859037Superfamily d.40.1: CI-2 family of serine protease inhibitors [54654] (1 family) (S)
  5. 859038Family d.40.1.1: CI-2 family of serine protease inhibitors [54655] (4 proteins)
  6. 859039Protein Chymotrypsin inhibitor CI-2 [54658] (1 species)
  7. 859040Species Barley (Hordeum vulgare) [TaxId:4513] [54659] (29 PDB entries)
    Uniprot Q40059 22-84
  8. 859049Domain d1y3ci1: 1y3c I:21-83 [144588]
    Other proteins in same PDB: d1y3ce1
    complexed with 15p, ca, cit, na; mutant

Details for d1y3ci1

PDB Entry: 1y3c (more details), 1.69 Å

PDB Description: crystal structure of the complex of subtilisin bpn' with chymotrypsin inhibitor 2 r62a mutant
PDB Compounds: (I:) chymotrypsin inhibitor 2

SCOP Domain Sequences for d1y3ci1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1y3ci1 d.40.1.1 (I:21-83) Chymotrypsin inhibitor CI-2 {Barley (Hordeum vulgare) [TaxId: 4513]}
ktewpelvgksveeakkvilqdkpaaqiivlpvgtivtmeyaidrvrlfvdrldniaqvp
rvg

SCOP Domain Coordinates for d1y3ci1:

Click to download the PDB-style file with coordinates for d1y3ci1.
(The format of our PDB-style files is described here.)

Timeline for d1y3ci1: