![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.40: CI-2 family of serine protease inhibitors [54653] (1 superfamily) alpha+beta sandwich; loop across free side of beta-sheet |
![]() | Superfamily d.40.1: CI-2 family of serine protease inhibitors [54654] (2 families) ![]() |
![]() | Family d.40.1.1: CI-2 family of serine protease inhibitors [54655] (5 proteins) automatically mapped to Pfam PF00280 |
![]() | Protein Chymotrypsin inhibitor CI-2 [54658] (1 species) |
![]() | Species Barley (Hordeum vulgare) [TaxId:4513] [54659] (29 PDB entries) Uniprot Q40059 22-84 |
![]() | Domain d1y34i1: 1y34 I:21-83 [144586] Other proteins in same PDB: d1y34e2, d1y34e3 complexed with 15p, ca, cit, na; mutant |
PDB Entry: 1y34 (more details), 1.55 Å
SCOPe Domain Sequences for d1y34i1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1y34i1 d.40.1.1 (I:21-83) Chymotrypsin inhibitor CI-2 {Barley (Hordeum vulgare) [TaxId: 4513]} ktewpelvgksveeakkvilqdkpaaqiivlpvgtivtmayridrvrlfvdrldniaqvp rvg
Timeline for d1y34i1: