SCOPe 2.07: Domain d1y33i1: 1y33 I:21-83

Lineage for d1y33i1 (1y33 I:21-83)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.40: CI-2 family of serine protease inhibitors [54653] (1 superfamily)
   alpha+beta sandwich; loop across free side of beta-sheet

4. Superfamily d.40.1: CI-2 family of serine protease inhibitors [54654] (2 families)

5. Family d.40.1.1: CI-2 family of serine protease inhibitors [54655] (5 proteins)
   automatically mapped to Pfam PF00280

6. Protein Chymotrypsin inhibitor CI-2 [54658] (1 species)

7. Species Barley (Hordeum vulgare) [TaxId:4513] [54659] (29 PDB entries)
   Uniprot Q40059 22-84

8. Domain d1y33i1: 1y33 I:21-83 [144585]
   Other proteins in same PDB: d1y33e2, d1y33e3
   complexed with 15p, ca, cit, na; mutant

Details for d1y33i1

PDB Entry: 1y33, 1.8 Å

PDB Description: crystal structure of the complex of subtilisin bpn' with chymotrypsin inhibitor 2 t58p mutant

PDB Compounds: (I:) chymotrypsin inhibitor 2

SCOPe Domain Sequences for d1y33i1:

Sequence; same for both SEQRES and ATOM records:

>d1y33i1 d.40.1.1 (I:21-83) Chymotrypsin inhibitor CI-2 {Barley (Hordeum vulgare) [TaxId: 4513]}
ktewpelvgksveeakkvilqdkpaaqiivlpvgtivpmeyridrvrlfvdrldniaqvp
rvg

Timeline for d1y33i1:

• d1y33i1 first appeared in SCOP 1.75
  
• d1y33i1 appears in SCOPe 2.06
  
• d1y33i1 appears in the current release, SCOPe 2.08