| Class b: All beta proteins [48724] (174 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.12: Purple acid phosphatase, N-terminal domain [49363] (2 families) ![]() |
| Family b.1.12.1: Purple acid phosphatase, N-terminal domain [49364] (1 protein) |
| Protein Purple acid phosphatase, N-terminal domain [49365] (2 species) |
| Species Sweet potato (Ipomoea batatas) [TaxId:4120] [117063] (1 PDB entry) Uniprot Q9SE00 39-462 |
| Domain d1xzwb3: 1xzw B:501-619 [144583] Other proteins in same PDB: d1xzwa2, d1xzwb2 complexed with fe, mn, nag, po4 |
PDB Entry: 1xzw (more details), 2.5 Å
SCOPe Domain Sequences for d1xzwb3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1xzwb3 b.1.12.1 (B:501-619) Purple acid phosphatase, N-terminal domain {Sweet potato (Ipomoea batatas) [TaxId: 4120]}
lpnaedvdmpwdsdvfavpsgynapqqvhitqgdyegrgviiswttpydkagankvfyws
ensksqkramgtvvtykyynytsafihhctikdleydtkyyyrlgfgdakrqfwfvtpp
Timeline for d1xzwb3: