Lineage for d1xzwb3 (1xzw B:501-619)

  1. Root: SCOPe 2.02
  2. 1103260Class b: All beta proteins [48724] (174 folds)
  3. 1103261Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1111428Superfamily b.1.12: Purple acid phosphatase, N-terminal domain [49363] (1 family) (S)
  5. 1111429Family b.1.12.1: Purple acid phosphatase, N-terminal domain [49364] (1 protein)
  6. 1111430Protein Purple acid phosphatase, N-terminal domain [49365] (2 species)
  7. 1111450Species Sweet potato (Ipomoea batatas) [TaxId:4120] [117063] (1 PDB entry)
    Uniprot Q9SE00 39-462
  8. 1111452Domain d1xzwb3: 1xzw B:501-619 [144583]
    Other proteins in same PDB: d1xzwa2, d1xzwb2
    complexed with fe, mn, nag, po4

Details for d1xzwb3

PDB Entry: 1xzw (more details), 2.5 Å

PDB Description: sweet potato purple acid phosphatase/phosphate complex
PDB Compounds: (B:) purple acid phosphatase

SCOPe Domain Sequences for d1xzwb3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xzwb3 b.1.12.1 (B:501-619) Purple acid phosphatase, N-terminal domain {Sweet potato (Ipomoea batatas) [TaxId: 4120]}
lpnaedvdmpwdsdvfavpsgynapqqvhitqgdyegrgviiswttpydkagankvfyws
ensksqkramgtvvtykyynytsafihhctikdleydtkyyyrlgfgdakrqfwfvtpp

SCOPe Domain Coordinates for d1xzwb3:

Click to download the PDB-style file with coordinates for d1xzwb3.
(The format of our PDB-style files is described here.)

Timeline for d1xzwb3:

View in 3D
Domains from same chain:
(mouse over for more information)
d1xzwb2