Lineage for d1xzwb3 (1xzw B:501-619)
- Root: SCOP 1.75
Class b: All beta proteins [48724] (174 folds) 
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.12: Purple acid phosphatase, N-terminal domain [49363] (1 family) 
Family b.1.12.1: Purple acid phosphatase, N-terminal domain [49364] (1 protein) Protein Purple acid phosphatase, N-terminal domain [49365] (2 species) 
Species Sweet potato (Ipomoea batatas) [TaxId:4120] [117063] (1 PDB entry)
Uniprot Q9SE00 39-462
Domain d1xzwb3: 1xzw B:501-619 [144583]
Other proteins in same PDB: d1xzwa2, d1xzwb2
complexed with fe, fuc, man, mn, nag, po4
Details for d1xzwb3
PDB Entry: 1xzw (more details), 2.5 Å
PDB Description: sweet potato purple acid phosphatase/phosphate complex
PDB Compounds: (B:) purple acid phosphataseSCOP Domain Sequences for d1xzwb3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1xzwb3 b.1.12.1 (B:501-619) Purple acid phosphatase, N-terminal domain {Sweet potato (Ipomoea batatas) [TaxId: 4120]}
lpnaedvdmpwdsdvfavpsgynapqqvhitqgdyegrgviiswttpydkagankvfyws
ensksqkramgtvvtykyynytsafihhctikdleydtkyyyrlgfgdakrqfwfvtpp
SCOP Domain Coordinates for d1xzwb3:
Click to download the PDB-style file with coordinates for d1xzwb3.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1xzwb3:
- d1xzwb3 is new in SCOP 1.75
- d1xzwb3 appears in SCOPe 2.01
- d1xzwb3 appears in the current release, SCOPe 2.08
