SCOP 1.75: Domain d1xwde1: 1xwd E:3-107

Lineage for d1xwde1 (1xwd E:3-107)

1. Root: SCOP 1.75

2. Class g: Small proteins [56992] (90 folds)

3. Fold g.17: Cystine-knot cytokines [57500] (1 superfamily)
   disulfide-rich fold; common core is all-beta

4. Superfamily g.17.1: Cystine-knot cytokines [57501] (7 families)

5. Family g.17.1.4: Gonadodropin/Follitropin [57528] (3 proteins)

6. Protein Follicle stimulating hormone, follitropin, beta chain [64562] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [64563] (2 PDB entries)

8. Domain d1xwde1: 1xwd E:3-107 [144582]
   Other proteins in same PDB: d1xwda1, d1xwdc1, d1xwdd1
   automatically matched to 1XWD B:3-107
   complexed with bma, nag, so4

Details for d1xwde1

PDB Entry: 1xwd, 2.92 Å

PDB Description: crystal structure of human follicle stimulating hormone complexed with its receptor

PDB Compounds: (E:) Follitropin beta chain

SCOP Domain Sequences for d1xwde1:

Sequence; same for both SEQRES and ATOM records:

>d1xwde1 g.17.1.4 (E:3-107) Follicle stimulating hormone, follitropin, beta chain {Human (Homo sapiens) [TaxId: 9606]}
celtnitiaiekeecrfcisinttwcagycytrdlvykdparpkiqktctfkelvyetvr
vpgcahhadslytypvatqchcgkcdsdstdctvrglgpsycsfg

Timeline for d1xwde1:

• d1xwde1 is new in SCOP 1.75
  
• d1xwde1 is called d1xwde_ in SCOPe 2.01
  
• d1xwde1 appears in the current release, SCOPe 2.08, called d1xwde_