Lineage for d1xwdc1 (1xwd C:18-259)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2459922Fold c.10: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) [52046] (3 superfamilies)
    2 curved layers, a/b; parallel beta-sheet; order 1234...N; there are sequence similarities between different superfamilies
  4. 2459991Superfamily c.10.2: L domain-like [52058] (9 families) (S)
    less regular structure consisting of variable repeats
  5. 2460154Family c.10.2.7: Ngr ectodomain-like [75142] (7 proteins)
    this is a repeat family; one repeat unit is 1xwd C:97-122 found in domain
  6. 2460161Protein Follicle-stimulating hormone receptor [159450] (1 species)
  7. 2460162Species Human (Homo sapiens) [TaxId:9606] [159451] (1 PDB entry)
    Uniprot P23945 18-259
  8. 2460163Domain d1xwdc1: 1xwd C:18-259 [144581]
    Other proteins in same PDB: d1xwda_, d1xwdb1, d1xwdd_, d1xwde_
    complexed with nag, so4

Details for d1xwdc1

PDB Entry: 1xwd (more details), 2.92 Å

PDB Description: crystal structure of human follicle stimulating hormone complexed with its receptor
PDB Compounds: (C:) Follicle stimulating hormone receptor

SCOPe Domain Sequences for d1xwdc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]}
chhrichcsnrvflcqeskvteipsdlprnaielrfvltklrviqkgafsgfgdlekiei
sqndvlevieadvfsnlpklheiriekannllyinpeafqnlpnlqyllisntgikhlpd
vhkihslqkvlldiqdninihtiernsfvglsfesvilwlnkngiqeihncafngtqlde
lnlsdnnnleelpndvfhgasgpvildisrtrihslpsyglenlkklrarstynlkklpt
le

SCOPe Domain Coordinates for d1xwdc1:

Click to download the PDB-style file with coordinates for d1xwdc1.
(The format of our PDB-style files is described here.)

Timeline for d1xwdc1: