SCOPe 2.05: Domain d1xwdc1: 1xwd C:18-259

Lineage for d1xwdc1 (1xwd C:18-259)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.10: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) [52046] (3 superfamilies)
   2 curved layers, a/b; parallel beta-sheet; order 1234...N; there are sequence similarities between different superfamilies

4. Superfamily c.10.2: L domain-like [52058] (9 families)
   less regular structure consisting of variable repeats

5. Family c.10.2.7: Ngr ectodomain-like [75142] (7 proteins)
   this is a repeat family; one repeat unit is 1xwd C:97-122 found in domain

6. Protein Follicle-stimulating hormone receptor [159450] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [159451] (1 PDB entry)
   Uniprot P23945 18-259

8. Domain d1xwdc1: 1xwd C:18-259 [144581]
   Other proteins in same PDB: d1xwda_, d1xwdb1, d1xwdd_, d1xwde_
   complexed with nag, so4

Details for d1xwdc1

PDB Entry: 1xwd, 2.92 Å

PDB Description: crystal structure of human follicle stimulating hormone complexed with its receptor

PDB Compounds: (C:) Follicle stimulating hormone receptor

SCOPe Domain Sequences for d1xwdc1:

Sequence; same for both SEQRES and ATOM records:

>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]}
chhrichcsnrvflcqeskvteipsdlprnaielrfvltklrviqkgafsgfgdlekiei
sqndvlevieadvfsnlpklheiriekannllyinpeafqnlpnlqyllisntgikhlpd
vhkihslqkvlldiqdninihtiernsfvglsfesvilwlnkngiqeihncafngtqlde
lnlsdnnnleelpndvfhgasgpvildisrtrihslpsyglenlkklrarstynlkklpt
le

Timeline for d1xwdc1:

• d1xwdc1 first appeared in SCOP 1.75
  
• d1xwdc1 appears in SCOPe 2.04
  
• d1xwdc1 appears in SCOPe 2.06
  
• d1xwdc1 appears in the current release, SCOPe 2.08