Lineage for d1xwdb1 (1xwd B:3-107)

  1. Root: SCOPe 2.06
  2. 2256768Class g: Small proteins [56992] (94 folds)
  3. 2260390Fold g.17: Cystine-knot cytokines [57500] (1 superfamily)
    disulfide-rich fold; common core is all-beta
  4. 2260391Superfamily g.17.1: Cystine-knot cytokines [57501] (8 families) (S)
  5. 2260649Family g.17.1.4: Gonadodropin/Follitropin [57528] (4 proteins)
  6. 2260650Protein Follicle stimulating hormone, follitropin, beta chain [64562] (1 species)
  7. 2260651Species Human (Homo sapiens) [TaxId:9606] [64563] (3 PDB entries)
  8. 2260652Domain d1xwdb1: 1xwd B:3-107 [144580]
    Other proteins in same PDB: d1xwda_, d1xwdc1, d1xwdd_, d1xwdf_
    complexed with nag, so4

Details for d1xwdb1

PDB Entry: 1xwd (more details), 2.92 Å

PDB Description: crystal structure of human follicle stimulating hormone complexed with its receptor
PDB Compounds: (B:) Follitropin beta chain

SCOPe Domain Sequences for d1xwdb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xwdb1 g.17.1.4 (B:3-107) Follicle stimulating hormone, follitropin, beta chain {Human (Homo sapiens) [TaxId: 9606]}
celtnitiaiekeecrfcisinttwcagycytrdlvykdparpkiqktctfkelvyetvr
vpgcahhadslytypvatqchcgkcdsdstdctvrglgpsycsfg

SCOPe Domain Coordinates for d1xwdb1:

Click to download the PDB-style file with coordinates for d1xwdb1.
(The format of our PDB-style files is described here.)

Timeline for d1xwdb1: