SCOP 1.75: Domain d1xkfb3: 1xkf B:2-123

Lineage for d1xkfb3 (1xkf B:2-123)

1. Root: SCOP 1.75

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.37: CBS-domain pair [54630] (1 superfamily)
   duplication: tandem repeat of two beta-X-beta-alpha-beta(2)-alpha motifs of similar sequences; 4 layers: a/b/b/a

4. Superfamily d.37.1: CBS-domain pair [54631] (1 family)

5. Family d.37.1.1: CBS-domain pair [54632] (20 proteins)
   Pfam PF00571; pairs of CBS domains dimerize to form a stable globular domain, a.k.a. Bateman domain

6. Protein Hypothetical protein Rv2626c [143142] (1 species)

7. Species Mycobacterium tuberculosis [TaxId:1773] [143143] (2 PDB entries)
   Uniprot O06186 2-124

8. Domain d1xkfb3: 1xkf B:2-123 [144579]
   complexed with zn

Details for d1xkfb3

PDB Entry: 1xkf, 1.9 Å

PDB Description: Crystal structure of Hypoxic Response Protein I (HRPI) with two coordinated zinc ions

PDB Compounds: (B:) hypothetical protein RV2626C

SCOP Domain Sequences for d1xkfb3:

Sequence; same for both SEQRES and ATOM records:

>d1xkfb3 d.37.1.1 (B:2-123) Hypothetical protein Rv2626c {Mycobacterium tuberculosis [TaxId: 1773]}
ttardimnagvtcvgehetltaaaqymrehdigalpicgdddrlhgmltdrdivikglaa
gldpntatagelardsiyyvdanasiqemlnvmeehqvrrvpvisehrlvgivteadiar
hl

Timeline for d1xkfb3:

• d1xkfb3 is new in SCOP 1.75
  
• d1xkfb3 appears in SCOPe 2.01
  
• d1xkfb3 appears in the current release, SCOPe 2.08