SCOPe 2.01: Domain d1xkfa3: 1xkf A:2-124

Lineage for d1xkfa3 (1xkf A:2-124)

1. Root: SCOPe 2.01

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.37: CBS-domain pair [54630] (1 superfamily)
   duplication: tandem repeat of two beta-X-beta-alpha-beta(2)-alpha motifs of similar sequences; 4 layers: a/b/b/a

4. Superfamily d.37.1: CBS-domain pair [54631] (2 families)

5. Family d.37.1.1: CBS-domain pair [54632] (21 proteins)
   Pfam PF00571; pairs of CBS domains dimerize to form a stable globular domain, a.k.a. Bateman domain

6. Protein Hypothetical protein Rv2626c [143142] (1 species)

7. Species Mycobacterium tuberculosis [TaxId:1773] [143143] (2 PDB entries)
   Uniprot O06186 2-124

8. Domain d1xkfa3: 1xkf A:2-124 [144578]
   complexed with zn

Details for d1xkfa3

PDB Entry: 1xkf, 1.9 Å

PDB Description: Crystal structure of Hypoxic Response Protein I (HRPI) with two coordinated zinc ions

PDB Compounds: (A:) hypothetical protein RV2626C

SCOPe Domain Sequences for d1xkfa3:

Sequence, based on SEQRES records:

>d1xkfa3 d.37.1.1 (A:2-124) Hypothetical protein Rv2626c {Mycobacterium tuberculosis [TaxId: 1773]}
ttardimnagvtcvgehetltaaaqymrehdigalpicgdddrlhgmltdrdivikglaa
gldpntatagelardsiyyvdanasiqemlnvmeehqvrrvpvisehrlvgivteadiar
hlp

Sequence, based on observed residues (ATOM records):

>d1xkfa3 d.37.1.1 (A:2-124) Hypothetical protein Rv2626c {Mycobacterium tuberculosis [TaxId: 1773]}
ttardimnagvtcvgehetltaaaqymrehdigalpicgdddrlhgmltdrdivikglaa
gldpntatagelaiyyvdanasiqemlnvmeehqvrrvpvisehrlvgivteadiarhlp

Timeline for d1xkfa3:

• d1xkfa3 first appeared in SCOP 1.75
  
• d1xkfa3 appears in SCOPe 2.02
  
• d1xkfa3 appears in the current release, SCOPe 2.08