Lineage for d1xkfa3 (1xkf A:2-124)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2167405Fold d.37: CBS-domain pair [54630] (1 superfamily)
    duplication: tandem repeat of two beta-X-beta-alpha-beta(2)-alpha motifs of similar sequences; 4 layers: a/b/b/a
  4. 2167406Superfamily d.37.1: CBS-domain pair [54631] (2 families) (S)
  5. 2167407Family d.37.1.1: CBS-domain pair [54632] (21 protein domains)
    Pfam PF00571; pairs of CBS domains dimerize to form a stable globular domain, a.k.a. Bateman domain
  6. 2167434Protein Hypothetical protein Rv2626c [143142] (1 species)
  7. 2167435Species Mycobacterium tuberculosis [TaxId:1773] [143143] (2 PDB entries)
    Uniprot O06186 2-124
  8. 2167438Domain d1xkfa3: 1xkf A:2-124 [144578]
    complexed with zn

Details for d1xkfa3

PDB Entry: 1xkf (more details), 1.9 Å

PDB Description: Crystal structure of Hypoxic Response Protein I (HRPI) with two coordinated zinc ions
PDB Compounds: (A:) hypothetical protein RV2626C

SCOPe Domain Sequences for d1xkfa3:

Sequence, based on SEQRES records: (download)

>d1xkfa3 d.37.1.1 (A:2-124) Hypothetical protein Rv2626c {Mycobacterium tuberculosis [TaxId: 1773]}
ttardimnagvtcvgehetltaaaqymrehdigalpicgdddrlhgmltdrdivikglaa
gldpntatagelardsiyyvdanasiqemlnvmeehqvrrvpvisehrlvgivteadiar
hlp

Sequence, based on observed residues (ATOM records): (download)

>d1xkfa3 d.37.1.1 (A:2-124) Hypothetical protein Rv2626c {Mycobacterium tuberculosis [TaxId: 1773]}
ttardimnagvtcvgehetltaaaqymrehdigalpicgdddrlhgmltdrdivikglaa
gldpntatagelaiyyvdanasiqemlnvmeehqvrrvpvisehrlvgivteadiarhlp

SCOPe Domain Coordinates for d1xkfa3:

Click to download the PDB-style file with coordinates for d1xkfa3.
(The format of our PDB-style files is described here.)

Timeline for d1xkfa3: