Lineage for d1x75b1 (1x75 B:363-494)

  1. Root: SCOP 1.75
  2. 883176Class e: Multi-domain proteins (alpha and beta) [56572] (66 folds)
  3. 884975Fold e.11: Type II DNA topoisomerase [56718] (1 superfamily)
    4 domains: (1) toprim alpha/beta; (2) "winged helix"-like; (3) alpha+beta; (4) all-alpha
  4. 884976Superfamily e.11.1: Type II DNA topoisomerase [56719] (1 family) (S)
  5. 884977Family e.11.1.1: Type II DNA topoisomerase [56720] (2 proteins)
    domain 2 contains the catalytic tyrosine residue
  6. 884978Protein DNA Gyrase A [56723] (1 species)
  7. 884979Species Escherichia coli [TaxId:562] [56724] (2 PDB entries)
  8. 884982Domain d1x75b1: 1x75 B:363-494 [144577]
    Other proteins in same PDB: d1x75c1, d1x75d1
    automatically matched to 1X75 A:363-494

Details for d1x75b1

PDB Entry: 1x75 (more details), 2.8 Å

PDB Description: CcdB:GyrA14 complex
PDB Compounds: (B:) DNA gyrase subunit A

SCOP Domain Sequences for d1x75b1:

Sequence, based on SEQRES records: (download)

>d1x75b1 e.11.1.1 (B:363-494) DNA Gyrase A {Escherichia coli [TaxId: 562]}
trrtifelrkardrahilealavalanidpiielirhaptpaeaktalvanpwqlgnvaa
mleragddaarpewlepefgvrdglyylteqqaqaildlrlqkltgleheklldeykell
dqiaellrilgs

Sequence, based on observed residues (ATOM records): (download)

>d1x75b1 e.11.1.1 (B:363-494) DNA Gyrase A {Escherichia coli [TaxId: 562]}
trrtifelrkardrahilealavalanidpiielirhaptpaeaktalvanpwqlgnvaa
mleddaarpewlepefgvrdglyylteqqaqaildlrlqkltgleheklldeykelldqi
aellrilgs

SCOP Domain Coordinates for d1x75b1:

Click to download the PDB-style file with coordinates for d1x75b1.
(The format of our PDB-style files is described here.)

Timeline for d1x75b1: