Lineage for d1x75a1 (1x75 A:363-494)

  1. Root: SCOPe 2.08
  2. Class e: Multi-domain proteins (alpha and beta) [56572] (74 folds)
  3. Fold e.11: Type II DNA topoisomerase C-terminal domain-like [56718] (1 superfamily)
    4 domains: (1) toprim alpha/beta; (2) "winged helix"-like; (3) alpha+beta; (4) all-alpha
  4. Superfamily e.11.1: Type II DNA topoisomerase C-terminal domain-like [56719] (2 families) (S)
  5. Family e.11.1.1: Type II DNA topoisomerase C-terminal domain-like [56720] (3 proteins)
    domain 2 contains the catalytic tyrosine residue
  6. Protein DNA Gyrase A [56723] (2 species)
  7. Species Escherichia coli [TaxId:562] [56724] (5 PDB entries)
  8. Domain d1x75a1: 1x75 A:363-494 [144576]
    Other proteins in same PDB: d1x75c_, d1x75d_
    CcdB-interacting subdomain only

Details for d1x75a1

PDB Entry: 1x75 (more details), 2.8 Å

PDB Description: CcdB:GyrA14 complex
PDB Compounds: (A:) DNA gyrase subunit A

SCOPe Domain Sequences for d1x75a1:

Sequence, based on SEQRES records: (download)

>d1x75a1 e.11.1.1 (A:363-494) DNA Gyrase A {Escherichia coli [TaxId: 562]}
trrtifelrkardrahilealavalanidpiielirhaptpaeaktalvanpwqlgnvaa
mleragddaarpewlepefgvrdglyylteqqaqaildlrlqkltgleheklldeykell
dqiaellrilgs

Sequence, based on observed residues (ATOM records): (download)

>d1x75a1 e.11.1.1 (A:363-494) DNA Gyrase A {Escherichia coli [TaxId: 562]}
trrtifelrkardrahilealavalanidpiielirhaptpaeaktalvanpwqlnvaam
leddaarpewlepefgvrdglyylteqqaqaildlrlqkltgleheklldeykelldqia
ellrilgs

SCOPe Domain Coordinates for d1x75a1 are not available.

Timeline for d1x75a1:

Domains from other chains:
(mouse over for more information)
d1x75b_, d1x75c_, d1x75d_