Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.9: Barstar-like [52037] (2 superfamilies) 2 layers, a/b; parallel beta-sheet of 3 strands, order 123 |
Superfamily c.9.1: Barstar-related [52038] (1 family) |
Family c.9.1.1: Barstar-related [52039] (2 proteins) |
Protein Barstar (barnase inhibitor) [52040] (1 species) |
Species Bacillus amyloliquefaciens [TaxId:1390] [52041] (15 PDB entries) |
Domain d1x1xd1: 1x1x D:1-89 [144570] Other proteins in same PDB: d1x1xa1, d1x1xb1, d1x1xc1 mutant |
PDB Entry: 1x1x (more details), 2.3 Å
SCOP Domain Sequences for d1x1xd1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1x1xd1 c.9.1.1 (D:1-89) Barstar (barnase inhibitor) {Bacillus amyloliquefaciens [TaxId: 1390]} kkavingeqirsisdlhqtlkkelalpeyygenldalwdaltgwveyplvlewrqfeqsk qltengaesvlqvfraakaegaditiils
Timeline for d1x1xd1: