SCOPe 2.06: Domain d1x1wf_: 1x1w F:

Lineage for d1x1wf_ (1x1w F:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.9: Barstar-like [52037] (2 superfamilies)
   2 layers, a/b; parallel beta-sheet of 3 strands, order 123

4. Superfamily c.9.1: Barstar-related [52038] (1 family)
   automatically mapped to Pfam PF01337

5. Family c.9.1.1: Barstar-related [52039] (3 proteins)

6. Protein automated matches [190697] (2 species)
   not a true protein

7. Species Bacillus amyloliquefaciens [TaxId:1390] [188456] (5 PDB entries)

8. Domain d1x1wf_: 1x1w F: [144569]
   Other proteins in same PDB: d1x1wa_, d1x1wb_, d1x1wc_, d1x1wd1
   automated match to d1b27d_

Details for d1x1wf_

PDB Entry: 1x1w, 2.1 Å

PDB Description: water-mediate interaction at aprotein-protein interface

PDB Compounds: (F:) barstar

SCOPe Domain Sequences for d1x1wf_:

Sequence; same for both SEQRES and ATOM records:

>d1x1wf_ c.9.1.1 (F:) automated matches {Bacillus amyloliquefaciens [TaxId: 1390]}
kkavingeqirsisdlhqtlkkelalpeyygenldalwdaltgwveyplvlewrqfeqsk
qltengaesvlqvfreakaagaditiils

Timeline for d1x1wf_:

• d1x1wf_ first appeared in SCOP 1.75, called d1x1wf1
  
• d1x1wf_ appears in SCOPe 2.05
  
• d1x1wf_ appears in SCOPe 2.07
  
• d1x1wf_ appears in the current release, SCOPe 2.08