Lineage for d1x1wf1 (1x1w F:1-89)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 823885Fold c.9: Barstar-like [52037] (2 superfamilies)
    2 layers, a/b; parallel beta-sheet of 3 strands, order 123
  4. 823886Superfamily c.9.1: Barstar-related [52038] (1 family) (S)
  5. 823887Family c.9.1.1: Barstar-related [52039] (2 proteins)
  6. 823888Protein Barstar (barnase inhibitor) [52040] (1 species)
  7. 823889Species Bacillus amyloliquefaciens [TaxId:1390] [52041] (15 PDB entries)
  8. 823902Domain d1x1wf1: 1x1w F:1-89 [144569]
    Other proteins in same PDB: d1x1wa1, d1x1wb1, d1x1wc1
    automatically matched to 1X1W D:1-89
    mutant

Details for d1x1wf1

PDB Entry: 1x1w (more details), 2.1 Å

PDB Description: water-mediate interaction at aprotein-protein interface
PDB Compounds: (F:) barstar

SCOP Domain Sequences for d1x1wf1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1x1wf1 c.9.1.1 (F:1-89) Barstar (barnase inhibitor) {Bacillus amyloliquefaciens [TaxId: 1390]}
kkavingeqirsisdlhqtlkkelalpeyygenldalwdaltgwveyplvlewrqfeqsk
qltengaesvlqvfreakaagaditiils

SCOP Domain Coordinates for d1x1wf1:

Click to download the PDB-style file with coordinates for d1x1wf1.
(The format of our PDB-style files is described here.)

Timeline for d1x1wf1: