Lineage for d1x1wd1 (1x1w D:1-89)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2851514Fold c.9: Barstar-like [52037] (2 superfamilies)
    2 layers, a/b; parallel beta-sheet of 3 strands, order 123
  4. 2851515Superfamily c.9.1: Barstar-related [52038] (1 family) (S)
    automatically mapped to Pfam PF01337
  5. 2851516Family c.9.1.1: Barstar-related [52039] (3 proteins)
  6. 2851517Protein Barstar (barnase inhibitor) [52040] (1 species)
  7. 2851518Species Bacillus amyloliquefaciens [TaxId:1390] [52041] (15 PDB entries)
  8. 2851527Domain d1x1wd1: 1x1w D:1-89 [144567]
    Other proteins in same PDB: d1x1wa_, d1x1wb_, d1x1wc_, d1x1we_, d1x1wf_

Details for d1x1wd1

PDB Entry: 1x1w (more details), 2.1 Å

PDB Description: water-mediate interaction at aprotein-protein interface
PDB Compounds: (D:) barstar

SCOPe Domain Sequences for d1x1wd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1x1wd1 c.9.1.1 (D:1-89) Barstar (barnase inhibitor) {Bacillus amyloliquefaciens [TaxId: 1390]}
kkavingeqirsisdlhqtlkkelalpeyygenldalwdaltgwveyplvlewrqfeqsk
qltengaesvlqvfreakaagaditiils

SCOPe Domain Coordinates for d1x1wd1:

Click to download the PDB-style file with coordinates for d1x1wd1.
(The format of our PDB-style files is described here.)

Timeline for d1x1wd1: