Lineage for d1wrda1 (1wrd A:215-307)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1724371Fold a.7: Spectrin repeat-like [46965] (16 superfamilies)
    3 helices; bundle, closed, left-handed twist; up-and-down
  4. 1724641Superfamily a.7.8: GAT-like domain [89009] (3 families) (S)
  5. 1724642Family a.7.8.1: GAT domain [89010] (4 proteins)
    this is a repeat family; one repeat unit is 1yd8 G:208-299 found in domain
  6. 1724659Protein Target of Myb protein 1, TOM1 [158361] (1 species)
  7. 1724660Species Human (Homo sapiens) [TaxId:9606] [158362] (1 PDB entry)
    Uniprot O60784 215-307
  8. 1724661Domain d1wrda1: 1wrd A:215-307 [144565]
    Other proteins in same PDB: d1wrdb_

Details for d1wrda1

PDB Entry: 1wrd (more details), 1.75 Å

PDB Description: Crystal structure of Tom1 GAT domain in complex with ubiquitin
PDB Compounds: (A:) Target of Myb protein 1

SCOPe Domain Sequences for d1wrda1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wrda1 a.7.8.1 (A:215-307) Target of Myb protein 1, TOM1 {Human (Homo sapiens) [TaxId: 9606]}
eqigklrselemvsgnvrvmsemltelvptqaepadlellqelnrtcramqqrvlelipq
ianeqlteellivndnlnnvflrherferfrtg

SCOPe Domain Coordinates for d1wrda1:

Click to download the PDB-style file with coordinates for d1wrda1.
(The format of our PDB-style files is described here.)

Timeline for d1wrda1: