![]() | Class a: All alpha proteins [46456] (284 folds) |
![]() | Fold a.7: Spectrin repeat-like [46965] (16 superfamilies) 3 helices; bundle, closed, left-handed twist; up-and-down |
![]() | Superfamily a.7.8: GAT-like domain [89009] (3 families) ![]() |
![]() | Family a.7.8.1: GAT domain [89010] (3 proteins) this is a repeat family; one repeat unit is 1yd8 G:208-299 found in domain |
![]() | Protein Target of Myb protein 1, TOM1 [158361] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [158362] (1 PDB entry) Uniprot O60784 215-307 |
![]() | Domain d1wrda1: 1wrd A:215-307 [144565] Other proteins in same PDB: d1wrdb_ |
PDB Entry: 1wrd (more details), 1.75 Å
SCOPe Domain Sequences for d1wrda1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1wrda1 a.7.8.1 (A:215-307) Target of Myb protein 1, TOM1 {Human (Homo sapiens) [TaxId: 9606]} eqigklrselemvsgnvrvmsemltelvptqaepadlellqelnrtcramqqrvlelipq ianeqlteellivndnlnnvflrherferfrtg
Timeline for d1wrda1: