![]() | Class a: All alpha proteins [46456] (289 folds) |
![]() | Fold a.7: Spectrin repeat-like [46965] (16 superfamilies) 3 helices; bundle, closed, left-handed twist; up-and-down |
![]() | Superfamily a.7.8: GAT-like domain [89009] (3 families) ![]() |
![]() | Family a.7.8.1: GAT domain [89010] (4 proteins) this is a repeat family; one repeat unit is 1yd8 G:208-299 found in domain |
![]() | Protein ADP-ribosylation factor binding protein Gga3 [158363] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [158364] (2 PDB entries) Uniprot Q9NZ52 208-299! Uniprot Q9NZ52 211-300 |
![]() | Domain d1wr6d_: 1wr6 D: [144564] Other proteins in same PDB: d1wr6e_, d1wr6f_, d1wr6g_, d1wr6h_ automated match to d1wr6a1 |
PDB Entry: 1wr6 (more details), 2.6 Å
SCOPe Domain Sequences for d1wr6d_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1wr6d_ a.7.8.1 (D:) ADP-ribosylation factor binding protein Gga3 {Human (Homo sapiens) [TaxId: 9606]} lhtleevnnnvrllsemllhysqedssdgdrelmkelfdqcenkrrtlfklasetedndn slgdilqasdnlsrvinsyktiiegqvi
Timeline for d1wr6d_: