Class a: All alpha proteins [46456] (284 folds) |
Fold a.7: Spectrin repeat-like [46965] (16 superfamilies) 3 helices; bundle, closed, left-handed twist; up-and-down |
Superfamily a.7.8: GAT-like domain [89009] (2 families) |
Family a.7.8.1: GAT domain [89010] (3 proteins) this is a repeat family; one repeat unit is 1yd8 G:208-299 found in domain |
Protein ADP-ribosylation factor binding protein Gga3 [158363] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [158364] (2 PDB entries) Uniprot Q9NZ52 208-299! Uniprot Q9NZ52 211-300 |
Domain d1wr6d1: 1wr6 D:215-300 [144564] Other proteins in same PDB: d1wr6e1, d1wr6f1, d1wr6g1, d1wr6h1 automatically matched to 1WR6 A:211-300 |
PDB Entry: 1wr6 (more details), 2.6 Å
SCOP Domain Sequences for d1wr6d1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1wr6d1 a.7.8.1 (D:215-300) ADP-ribosylation factor binding protein Gga3 {Human (Homo sapiens) [TaxId: 9606]} lhtleevnnnvrllsemllhysqedssdgdrelmkelfdqcenkrrtlfklasetedndn slgdilqasdnlsrvinsyktiiegq
Timeline for d1wr6d1: