Lineage for d1wr6b1 (1wr6 B:215-300)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 763928Fold a.7: Spectrin repeat-like [46965] (16 superfamilies)
    3 helices; bundle, closed, left-handed twist; up-and-down
  4. 764132Superfamily a.7.8: GAT-like domain [89009] (2 families) (S)
  5. 764133Family a.7.8.1: GAT domain [89010] (3 proteins)
    this is a repeat family; one repeat unit is 1yd8 G:208-299 found in domain
  6. 764142Protein ADP-ribosylation factor binding protein Gga3 [158363] (1 species)
  7. 764143Species Human (Homo sapiens) [TaxId:9606] [158364] (2 PDB entries)
    Uniprot Q9NZ52 208-299! Uniprot Q9NZ52 211-300
  8. 764145Domain d1wr6b1: 1wr6 B:215-300 [144562]
    Other proteins in same PDB: d1wr6e1, d1wr6f1, d1wr6g1, d1wr6h1
    automatically matched to 1WR6 A:211-300

Details for d1wr6b1

PDB Entry: 1wr6 (more details), 2.6 Å

PDB Description: Crystal structure of GGA3 GAT domain in complex with ubiquitin
PDB Compounds: (B:) ADP-ribosylation factor binding protein gga3

SCOP Domain Sequences for d1wr6b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wr6b1 a.7.8.1 (B:215-300) ADP-ribosylation factor binding protein Gga3 {Human (Homo sapiens) [TaxId: 9606]}
lhtleevnnnvrllsemllhysqedssdgdrelmkelfdqcenkrrtlfklasetedndn
slgdilqasdnlsrvinsyktiiegq

SCOP Domain Coordinates for d1wr6b1:

Click to download the PDB-style file with coordinates for d1wr6b1.
(The format of our PDB-style files is described here.)

Timeline for d1wr6b1: