SCOPe 2.08: Domain d1wr6b_: 1wr6 B:

Lineage for d1wr6b_ (1wr6 B:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.7: Spectrin repeat-like [46965] (16 superfamilies)
   3 helices; bundle, closed, left-handed twist; up-and-down

4. Superfamily a.7.8: GAT-like domain [89009] (3 families)

5. Family a.7.8.1: GAT domain [89010] (4 proteins)
   this is a repeat family; one repeat unit is 1yd8 G:208-299 found in domain

6. Protein ADP-ribosylation factor binding protein Gga3 [158363] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [158364] (2 PDB entries)
   Uniprot Q9NZ52 208-299! Uniprot Q9NZ52 211-300

8. Domain d1wr6b_: 1wr6 B: [144562]
   Other proteins in same PDB: d1wr6e_, d1wr6f_, d1wr6g_, d1wr6h_
   automated match to d1wr6a1

Details for d1wr6b_

PDB Entry: 1wr6, 2.6 Å

PDB Description: Crystal structure of GGA3 GAT domain in complex with ubiquitin

PDB Compounds: (B:) ADP-ribosylation factor binding protein gga3

SCOPe Domain Sequences for d1wr6b_:

Sequence; same for both SEQRES and ATOM records:

>d1wr6b_ a.7.8.1 (B:) ADP-ribosylation factor binding protein Gga3 {Human (Homo sapiens) [TaxId: 9606]}
lhtleevnnnvrllsemllhysqedssdgdrelmkelfdqcenkrrtlfklasetedndn
slgdilqasdnlsrvinsyktiiegqving

Timeline for d1wr6b_:

• d1wr6b_ first appeared in SCOP 1.75, called d1wr6b1
  
• d1wr6b_ appears in SCOPe 2.07