Lineage for d1w98b1 (1w98 B:228-357)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2331190Fold a.74: Cyclin-like [47953] (1 superfamily)
    core: 5 helices; one helix is surrounded by the others
  4. 2331191Superfamily a.74.1: Cyclin-like [47954] (4 families) (S)
    duplication: consists of two domains of this fold
  5. 2331192Family a.74.1.1: Cyclin [47955] (9 proteins)
  6. 2331642Protein G1/S-specific cyclin-E1 [158597] (1 species)
  7. 2331643Species Human (Homo sapiens) [TaxId:9606] [158598] (1 PDB entry)
    Uniprot P24864 103-242! Uniprot P24864 243-372
  8. 2331644Domain d1w98b1: 1w98 B:228-357 [144548]
    Other proteins in same PDB: d1w98a2, d1w98a3

Details for d1w98b1

PDB Entry: 1w98 (more details), 2.15 Å

PDB Description: the structural basis of cdk2 activation by cyclin e
PDB Compounds: (B:) g1/s-specific cyclin e1

SCOPe Domain Sequences for d1w98b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1w98b1 a.74.1.1 (B:228-357) G1/S-specific cyclin-E1 {Human (Homo sapiens) [TaxId: 9606]}
pltivswlnvymqvaylndlhevllpqypqqifiqiaelldlcvldvdclefpygilaas
alyhfssselmqkvsgyqwcdiencvkwmvpfamviretgssklkhfrgvadedahniqt
hrdsldlldk

SCOPe Domain Coordinates for d1w98b1:

Click to download the PDB-style file with coordinates for d1w98b1.
(The format of our PDB-style files is described here.)

Timeline for d1w98b1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1w98b2