Lineage for d1w3ra1 (1w3r A:2-195)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2794132Fold b.45: Split barrel-like [50474] (3 superfamilies)
    barrel; n=6, S=10; greek-key
  4. 2794133Superfamily b.45.1: FMN-binding split barrel [50475] (5 families) (S)
    related to the ferredoxin reductase-like FAD-binding domain
  5. 2794134Family b.45.1.1: PNP-oxidase like [50476] (17 proteins)
  6. 2794210Protein NimA-related protein DR0842 [117228] (1 species)
  7. 2794211Species Deinococcus radiodurans [TaxId:1299] [117229] (4 PDB entries)
    Uniprot Q9RW27
  8. 2794215Domain d1w3ra1: 1w3r A:2-195 [144547]
    Other proteins in same PDB: d1w3ra2
    complexed with 2mn, act, pyr

Details for d1w3ra1

PDB Entry: 1w3r (more details), 1.9 Å

PDB Description: nima from d. radiodurans with metronidazole and pyruvate
PDB Compounds: (A:) nima-related protein

SCOPe Domain Sequences for d1w3ra1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1w3ra1 b.45.1.1 (A:2-195) NimA-related protein DR0842 {Deinococcus radiodurans [TaxId: 1299]}
sdfydprerdpsvsrrpqnrqsdewirelllrgtiarvatlwqgedgaafpfitplayay
rpeqgdlvyhtnvvgrlranagqghpatlevseigqflpsnsplelsvqyrsvmvfgtar
vlagedaraalttlservfpglkvgettrpiseddlkrtsvyslsidrwsgkenwaeqai
qeedwpalgpewlg

SCOPe Domain Coordinates for d1w3ra1:

Click to download the PDB-style file with coordinates for d1w3ra1.
(The format of our PDB-style files is described here.)

Timeline for d1w3ra1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1w3ra2