![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.45: Split barrel-like [50474] (3 superfamilies) barrel; n=6, S=10; greek-key |
![]() | Superfamily b.45.1: FMN-binding split barrel [50475] (5 families) ![]() related to the ferredoxin reductase-like FAD-binding domain |
![]() | Family b.45.1.1: PNP-oxidase like [50476] (17 proteins) |
![]() | Protein NimA-related protein DR0842 [117228] (1 species) |
![]() | Species Deinococcus radiodurans [TaxId:1299] [117229] (4 PDB entries) Uniprot Q9RW27 |
![]() | Domain d1w3ra1: 1w3r A:2-195 [144547] Other proteins in same PDB: d1w3ra2 complexed with 2mn, act, pyr |
PDB Entry: 1w3r (more details), 1.9 Å
SCOPe Domain Sequences for d1w3ra1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1w3ra1 b.45.1.1 (A:2-195) NimA-related protein DR0842 {Deinococcus radiodurans [TaxId: 1299]} sdfydprerdpsvsrrpqnrqsdewirelllrgtiarvatlwqgedgaafpfitplayay rpeqgdlvyhtnvvgrlranagqghpatlevseigqflpsnsplelsvqyrsvmvfgtar vlagedaraalttlservfpglkvgettrpiseddlkrtsvyslsidrwsgkenwaeqai qeedwpalgpewlg
Timeline for d1w3ra1: