Class b: All beta proteins [48724] (176 folds) |
Fold b.69: 7-bladed beta-propeller [50964] (14 superfamilies) consists of seven 4-stranded beta-sheet motifs; meander |
Superfamily b.69.4: WD40 repeat-like [50978] (4 families) also contains 8-bladed propellers |
Family b.69.4.1: WD40-repeat [50979] (12 proteins) this is a repeat family; one repeat unit is 1tyq C:201-243 found in domain |
Protein Platelet-activating factor acetylhydrolase IB subunit alpha [159257] (1 species) |
Species Mouse (Mus musculus) [TaxId:10090] [159258] (1 PDB entry) Uniprot P43034 91-407 |
Domain d1vyhl1: 1vyh L:92-408 [144539] Other proteins in same PDB: d1vyha1, d1vyhb1, d1vyhe1, d1vyhf1, d1vyhi1, d1vyhj1, d1vyhm1, d1vyhn1, d1vyhq1, d1vyhr1 automatically matched to 1VYH C:92-408 |
PDB Entry: 1vyh (more details), 3.4 Å
SCOPe Domain Sequences for d1vyhl1:
Sequence, based on SEQRES records: (download)
>d1vyhl1 b.69.4.1 (L:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} kewiprppekyalsghrspvtrvifhpvfsvmvsasedatikvwdyetgdfertlkghtd svqdisfdhsgkllascsadmtiklwdfqgfecirtmhghdhnvssvsimpngdhivsas rdktikmwevqtgycvktftghrewvrmvrpnqdgtliascsndqtvrvwvvatkeckae lrehrhvveciswapessyssiseatgsetkksgkpgpfllsgsrdktikmwdvstgmcl mtlvghdnwvrgvlfhsggkfilscaddktlrvwdyknkrcmktlnahehfvtsldfhkt apyvvtgsvdqtvkvwe
>d1vyhl1 b.69.4.1 (L:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} kewiprppekyalsghrspvtrvifhpvfsvmvsasedatikvwdyetgdfertlkghtd svqdisfdhsgkllascsadmtiklwdfqgfecirtmhghdhnvssvsimpngdhivsas rdktikmwevqtgycvktftghrewvrmvrpnqdgtliascsndqtvrvwvvatkeckae lrehrhvveciswapessyssiseatgsegpfllsgsrdktikmwdvstgmclmtlvghd nwvrgvlfhsggkfilscaddktlrvwdyknkrcmktlnahehfvtsldfhktapyvvtg svdqtvkvwe
Timeline for d1vyhl1: