Lineage for d1vyhl1 (1vyh L:92-408)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2065823Fold b.69: 7-bladed beta-propeller [50964] (15 superfamilies)
    consists of seven 4-stranded beta-sheet motifs; meander
  4. 2065971Superfamily b.69.4: WD40 repeat-like [50978] (4 families) (S)
    also contains 8-bladed propellers
  5. 2065972Family b.69.4.1: WD40-repeat [50979] (13 protein domains)
  6. 2066056Protein Platelet-activating factor acetylhydrolase IB subunit alpha [159257] (1 species)
  7. 2066057Species Mouse (Mus musculus) [TaxId:10090] [159258] (1 PDB entry)
    Uniprot P43034 91-407
  8. 2066063Domain d1vyhl1: 1vyh L:92-408 [144539]
    Other proteins in same PDB: d1vyha1, d1vyhb1, d1vyhe1, d1vyhf1, d1vyhi1, d1vyhj1, d1vyhm1, d1vyhn1, d1vyhq1, d1vyhr1
    automatically matched to 1VYH C:92-408

Details for d1vyhl1

PDB Entry: 1vyh (more details), 3.4 Å

PDB Description: paf-ah holoenzyme: lis1/alfa2
PDB Compounds: (L:) platelet-activating factor acetylhydrolase ib alpha subunit

SCOPe Domain Sequences for d1vyhl1:

Sequence, based on SEQRES records: (download)

>d1vyhl1 b.69.4.1 (L:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]}
kewiprppekyalsghrspvtrvifhpvfsvmvsasedatikvwdyetgdfertlkghtd
svqdisfdhsgkllascsadmtiklwdfqgfecirtmhghdhnvssvsimpngdhivsas
rdktikmwevqtgycvktftghrewvrmvrpnqdgtliascsndqtvrvwvvatkeckae
lrehrhvveciswapessyssiseatgsetkksgkpgpfllsgsrdktikmwdvstgmcl
mtlvghdnwvrgvlfhsggkfilscaddktlrvwdyknkrcmktlnahehfvtsldfhkt
apyvvtgsvdqtvkvwe

Sequence, based on observed residues (ATOM records): (download)

>d1vyhl1 b.69.4.1 (L:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]}
kewiprppekyalsghrspvtrvifhpvfsvmvsasedatikvwdyetgdfertlkghtd
svqdisfdhsgkllascsadmtiklwdfqgfecirtmhghdhnvssvsimpngdhivsas
rdktikmwevqtgycvktftghrewvrmvrpnqdgtliascsndqtvrvwvvatkeckae
lrehrhvveciswapessyssiseatgsegpfllsgsrdktikmwdvstgmclmtlvghd
nwvrgvlfhsggkfilscaddktlrvwdyknkrcmktlnahehfvtsldfhktapyvvtg
svdqtvkvwe

SCOPe Domain Coordinates for d1vyhl1:

Click to download the PDB-style file with coordinates for d1vyhl1.
(The format of our PDB-style files is described here.)

Timeline for d1vyhl1: