![]() | Class j: Peptides [58231] (120 folds) |
![]() | Fold j.118: Ribosomal protein L34p [144320] (1 superfamily) non-globular, mainly alpha-helical |
![]() | Superfamily j.118.1: Ribosomal protein L34p [144321] (1 family) ![]() |
![]() | Family j.118.1.1: Ribosomal protein L34p [144322] (1 protein) Pfam PF00468 |
![]() | Protein Ribosomal protein L34p [144323] (3 species) |
![]() | Species Thermus thermophilus [TaxId:274] [161306] (11 PDB entries) Uniprot P80340 1-49 |
![]() | Domain d1vsaz1: 1vsa Z:1-48 [144533] Other proteins in same PDB: d1vsaa1, d1vsab1, d1vsac1, d1vsaf1, d1vsaf2, d1vsah1, d1vsai1, d1vsaj1, d1vsal1, d1vsam1, d1vsao1, d1vsap1, d1vsaq1, d1vsar1, d1vsas1, d1vsat1, d1vsau1, d1vsaw1, d1vsax1 automatically matched to 2J01 7:1-49 protein/RNA complex |
PDB Entry: 1vsa (more details), 3.71 Å
SCOPe Domain Sequences for d1vsaz1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1vsaz1 j.118.1.1 (Z:1-48) Ribosomal protein L34p {Thermus thermophilus [TaxId: 274]} mkrtwqpnrrkrakthgfrarmrtpggrkvlkrrrqkgrwrltpavrk
Timeline for d1vsaz1: