Lineage for d1vsaz1 (1vsa Z:1-48)

  1. Root: SCOPe 2.01
  2. 1072259Class j: Peptides [58231] (120 folds)
  3. 1074064Fold j.118: Ribosomal protein L34p [144320] (1 superfamily)
    non-globular, mainly alpha-helical
  4. 1074065Superfamily j.118.1: Ribosomal protein L34p [144321] (1 family) (S)
  5. 1074066Family j.118.1.1: Ribosomal protein L34p [144322] (1 protein)
    Pfam PF00468
  6. 1074067Protein Ribosomal protein L34p [144323] (3 species)
  7. 1074088Species Thermus thermophilus [TaxId:274] [161306] (11 PDB entries)
    Uniprot P80340 1-49
  8. 1074099Domain d1vsaz1: 1vsa Z:1-48 [144533]
    Other proteins in same PDB: d1vsaa1, d1vsab1, d1vsac1, d1vsaf1, d1vsaf2, d1vsah1, d1vsai1, d1vsaj1, d1vsal1, d1vsam1, d1vsao1, d1vsap1, d1vsaq1, d1vsar1, d1vsas1, d1vsat1, d1vsau1, d1vsaw1, d1vsax1
    automatically matched to 2J01 7:1-49
    protein/RNA complex

Details for d1vsaz1

PDB Entry: 1vsa (more details), 3.71 Å

PDB Description: Crystal Structure of a 70S Ribosome-tRNA Complex Reveals Functional Interactions and Rearrangements. This file, 1VSA, contains the 50S ribosome subunit. 30S ribosome subunit is in the file 2OW8
PDB Compounds: (Z:) 50S ribosomal protein L34

SCOPe Domain Sequences for d1vsaz1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vsaz1 j.118.1.1 (Z:1-48) Ribosomal protein L34p {Thermus thermophilus [TaxId: 274]}
mkrtwqpnrrkrakthgfrarmrtpggrkvlkrrrqkgrwrltpavrk

SCOPe Domain Coordinates for d1vsaz1:

Click to download the PDB-style file with coordinates for d1vsaz1.
(The format of our PDB-style files is described here.)

Timeline for d1vsaz1: