![]() | Class b: All beta proteins [48724] (174 folds) |
![]() | Fold b.53: Ribosomal protein L25-like [50714] (1 superfamily) barrel, closed; n=6, S=10; complex topology |
![]() | Superfamily b.53.1: Ribosomal protein L25-like [50715] (2 families) ![]() |
![]() | Family b.53.1.1: Ribosomal protein L25-like [50716] (2 proteins) |
![]() | Protein Ribosomal protein TL5 (general stress protein CTC) [63798] (2 species) contains additional all-beta (sub)domain in the C-terminal extension |
![]() | Species Thermus thermophilus [TaxId:274] [63799] (16 PDB entries) |
![]() | Domain d1vsat1: 1vsa T:3-179 [144531] Other proteins in same PDB: d1vsaa1, d1vsab1, d1vsac1, d1vsaf1, d1vsaf2, d1vsah1, d1vsai1, d1vsaj1, d1vsal1, d1vsam1, d1vsao1, d1vsap1, d1vsaq1, d1vsar1, d1vsas1, d1vsau1, d1vsaw1, d1vsax1, d1vsaz1 automatically matched to 2J01 Z:3-179 protein/RNA complex |
PDB Entry: 1vsa (more details), 3.71 Å
SCOPe Domain Sequences for d1vsat1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1vsat1 b.53.1.1 (T:3-179) Ribosomal protein TL5 (general stress protein CTC) {Thermus thermophilus [TaxId: 274]} yrlkayyregekpsalrragklpgvmynrhlnrkvyvdlvefdkvfrqasihhvivlelp dgqslptlvrqvnldkrrrrpehvdffvlsdepvemyvplrfvgtpagvraggvlqeihr dilvkvsprnipefievdvsgleigdslhasdlklppgvelavspeetiaavvpped
Timeline for d1vsat1: