Lineage for d1vsat1 (1vsa T:3-179)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 957115Fold b.53: Ribosomal protein L25-like [50714] (1 superfamily)
    barrel, closed; n=6, S=10; complex topology
  4. 957116Superfamily b.53.1: Ribosomal protein L25-like [50715] (2 families) (S)
  5. 957117Family b.53.1.1: Ribosomal protein L25-like [50716] (2 proteins)
  6. 957152Protein Ribosomal protein TL5 (general stress protein CTC) [63798] (2 species)
    contains additional all-beta (sub)domain in the C-terminal extension
  7. 957164Species Thermus thermophilus [TaxId:274] [63799] (12 PDB entries)
  8. 957177Domain d1vsat1: 1vsa T:3-179 [144531]
    Other proteins in same PDB: d1vsaa1, d1vsab1, d1vsac1, d1vsaf1, d1vsaf2, d1vsah1, d1vsai1, d1vsaj1, d1vsal1, d1vsam1, d1vsao1, d1vsap1, d1vsaq1, d1vsar1, d1vsas1, d1vsau1, d1vsaw1, d1vsax1, d1vsaz1
    automatically matched to 2J01 Z:3-179
    protein/RNA complex

Details for d1vsat1

PDB Entry: 1vsa (more details), 3.71 Å

PDB Description: Crystal Structure of a 70S Ribosome-tRNA Complex Reveals Functional Interactions and Rearrangements. This file, 1VSA, contains the 50S ribosome subunit. 30S ribosome subunit is in the file 2OW8
PDB Compounds: (T:) 50S ribosomal protein L25

SCOPe Domain Sequences for d1vsat1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vsat1 b.53.1.1 (T:3-179) Ribosomal protein TL5 (general stress protein CTC) {Thermus thermophilus [TaxId: 274]}
yrlkayyregekpsalrragklpgvmynrhlnrkvyvdlvefdkvfrqasihhvivlelp
dgqslptlvrqvnldkrrrrpehvdffvlsdepvemyvplrfvgtpagvraggvlqeihr
dilvkvsprnipefievdvsgleigdslhasdlklppgvelavspeetiaavvpped

SCOPe Domain Coordinates for d1vsat1:

Click to download the PDB-style file with coordinates for d1vsat1.
(The format of our PDB-style files is described here.)

Timeline for d1vsat1: