Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.12: Ribosomal proteins S24e, L23 and L15e [54188] (1 superfamily) beta-(alpha)-beta-alpha-beta(2); 3 layers: alpha/beta/alpha; antiparallel beta-sheet: order 1243 |
Superfamily d.12.1: Ribosomal proteins S24e, L23 and L15e [54189] (3 families) |
Family d.12.1.1: L23p [54190] (1 protein) automatically mapped to Pfam PF00276 |
Protein Ribosomal protein L23 [54191] (4 species) |
Species Thermus thermophilus [TaxId:274] [89815] (11 PDB entries) |
Domain d1vsar1: 1vsa R:3-94 [144529] Other proteins in same PDB: d1vsaa1, d1vsab1, d1vsac1, d1vsaf1, d1vsaf2, d1vsah1, d1vsai1, d1vsaj1, d1vsal1, d1vsam1, d1vsao1, d1vsap1, d1vsaq1, d1vsas1, d1vsat1, d1vsau1, d1vsaw1, d1vsax1, d1vsaz1 protein/RNA complex protein/RNA complex |
PDB Entry: 1vsa (more details), 3.71 Å
SCOPe Domain Sequences for d1vsar1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1vsar1 d.12.1.1 (R:3-94) Ribosomal protein L23 {Thermus thermophilus [TaxId: 274]} taydvilapvlsekayagfaegkytfwvhpkatkteiknavetafkvkvvkvntlhvrgk kkrlgrylgkrpdrkkaivqvapgqkiealeg
Timeline for d1vsar1: