Lineage for d1vsap1 (1vsa P:1-101)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2089175Fold b.155: L21p-like [141090] (1 superfamily)
    core: sandwich, 6 strands in 2 sheets
  4. 2089176Superfamily b.155.1: L21p-like [141091] (1 family) (S)
    automatically mapped to Pfam PF00829
  5. 2089177Family b.155.1.1: Ribosomal protein L21p [141092] (1 protein)
    Pfam PF00829
  6. 2089178Protein Ribosomal protein L21p [141093] (3 species)
  7. 2089214Species Thermus thermophilus [TaxId:274] [158939] (15 PDB entries)
    Uniprot P60492 1-101
  8. 2089225Domain d1vsap1: 1vsa P:1-101 [144527]
    Other proteins in same PDB: d1vsaa1, d1vsab1, d1vsac1, d1vsaf1, d1vsaf2, d1vsah1, d1vsai1, d1vsaj1, d1vsal1, d1vsam1, d1vsao1, d1vsaq1, d1vsar1, d1vsas1, d1vsat1, d1vsau1, d1vsaw1, d1vsax1, d1vsaz1
    protein/RNA complex
    protein/RNA complex

Details for d1vsap1

PDB Entry: 1vsa (more details), 3.71 Å

PDB Description: Crystal Structure of a 70S Ribosome-tRNA Complex Reveals Functional Interactions and Rearrangements. This file, 1VSA, contains the 50S ribosome subunit. 30S ribosome subunit is in the file 2OW8
PDB Compounds: (P:) 50S ribosomal protein L21

SCOPe Domain Sequences for d1vsap1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vsap1 b.155.1.1 (P:1-101) Ribosomal protein L21p {Thermus thermophilus [TaxId: 274]}
mfaivktggkqyrvepglklrvekldaepgatvelpvlllggektvvgtpvvegasvvae
vlghgrgkkilvskfkakvqyrrkkghrqpytellikeirg

SCOPe Domain Coordinates for d1vsap1:

Click to download the PDB-style file with coordinates for d1vsap1.
(The format of our PDB-style files is described here.)

Timeline for d1vsap1: