| Class b: All beta proteins [48724] (174 folds) |
| Fold b.155: L21p-like [141090] (1 superfamily) core: sandwich, 6 strands in 2 sheets |
Superfamily b.155.1: L21p-like [141091] (1 family) ![]() |
| Family b.155.1.1: Ribosomal protein L21p [141092] (1 protein) Pfam PF00829 |
| Protein Ribosomal protein L21p [141093] (3 species) |
| Species Thermus thermophilus [TaxId:274] [158939] (11 PDB entries) Uniprot P60492 1-101 |
| Domain d1vsap1: 1vsa P:1-101 [144527] Other proteins in same PDB: d1vsaa1, d1vsab1, d1vsac1, d1vsaf1, d1vsaf2, d1vsah1, d1vsai1, d1vsaj1, d1vsal1, d1vsam1, d1vsao1, d1vsaq1, d1vsar1, d1vsas1, d1vsat1, d1vsau1, d1vsaw1, d1vsax1, d1vsaz1 automatically matched to 2HGJ U:1-101 protein/RNA complex |
PDB Entry: 1vsa (more details), 3.71 Å
SCOPe Domain Sequences for d1vsap1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1vsap1 b.155.1.1 (P:1-101) Ribosomal protein L21p {Thermus thermophilus [TaxId: 274]}
mfaivktggkqyrvepglklrvekldaepgatvelpvlllggektvvgtpvvegasvvae
vlghgrgkkilvskfkakvqyrrkkghrqpytellikeirg
Timeline for d1vsap1: