![]() | Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
![]() | Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
![]() | Superfamily c.55.4: Translational machinery components [53137] (2 families) ![]() |
![]() | Family c.55.4.1: Ribosomal protein L18 and S11 [53138] (2 proteins) |
![]() | Protein Ribosomal protein L18 (L18p) [53139] (5 species) |
![]() | Species Thermus thermophilus [TaxId:274] [75245] (7 PDB entries) |
![]() | Domain d1vsam1: 1vsa M:23-108 [144525] Other proteins in same PDB: d1vsaa1, d1vsab1, d1vsac1, d1vsaf1, d1vsaf2, d1vsah1, d1vsai1, d1vsaj1, d1vsal1, d1vsao1, d1vsap1, d1vsaq1, d1vsar1, d1vsas1, d1vsat1, d1vsau1, d1vsaw1, d1vsax1, d1vsaz1 automatically matched to d1ilya_ protein/RNA complex |
PDB Entry: 1vsa (more details), 3.71 Å
SCOPe Domain Sequences for d1vsam1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1vsam1 c.55.4.1 (M:23-108) Ribosomal protein L18 (L18p) {Thermus thermophilus [TaxId: 274]} rlrlsvfrslkhiyaqiiddekgvtlvsasslalklkgnktevarqvgralaekalalgi kqvafdrgpykyhgrvkalaegareg
Timeline for d1vsam1: