Lineage for d1vsaj1 (1vsa J:5-150)

  1. Root: SCOPe 2.01
  2. 968085Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 980515Fold c.12: Ribosomal proteins L15p and L18e [52079] (1 superfamily)
    core: three turns of irregular (beta-beta-alpha)n superhelix
  4. 980516Superfamily c.12.1: Ribosomal proteins L15p and L18e [52080] (1 family) (S)
  5. 980517Family c.12.1.1: Ribosomal proteins L15p and L18e [52081] (2 proteins)
  6. 980518Protein Ribosomal protein L15 (L15p) [52082] (4 species)
  7. 980597Species Thermus thermophilus [TaxId:274] [159454] (11 PDB entries)
    Uniprot Q72I23 5-150
  8. 980608Domain d1vsaj1: 1vsa J:5-150 [144523]
    Other proteins in same PDB: d1vsaa1, d1vsab1, d1vsac1, d1vsaf1, d1vsaf2, d1vsah1, d1vsai1, d1vsal1, d1vsam1, d1vsao1, d1vsap1, d1vsaq1, d1vsar1, d1vsas1, d1vsat1, d1vsau1, d1vsaw1, d1vsax1, d1vsaz1
    automatically matched to 2J01 P:5-150
    protein/RNA complex

Details for d1vsaj1

PDB Entry: 1vsa (more details), 3.71 Å

PDB Description: Crystal Structure of a 70S Ribosome-tRNA Complex Reveals Functional Interactions and Rearrangements. This file, 1VSA, contains the 50S ribosome subunit. 30S ribosome subunit is in the file 2OW8
PDB Compounds: (J:) 50S ribosomal protein L15

SCOPe Domain Sequences for d1vsaj1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vsaj1 c.12.1.1 (J:5-150) Ribosomal protein L15 (L15p) {Thermus thermophilus [TaxId: 274]}
dlrpnpgankrrkrvgrgpgsghgktatrghkgqksrsgglkdprrfeggrsttlmrlpk
rgmqgqvpgeikrpryqgvnlkdlarfegevtpellvragllkkgyrlkilgegeakplk
vvahafsksaleklkaaggepvllea

SCOPe Domain Coordinates for d1vsaj1:

Click to download the PDB-style file with coordinates for d1vsaj1.
(The format of our PDB-style files is described here.)

Timeline for d1vsaj1: