Lineage for d1vsai1 (1vsa I:1-122)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2057998Fold b.39: Ribosomal protein L14 [50192] (1 superfamily)
    barrel, closed; n=5, S=8, meander
  4. 2057999Superfamily b.39.1: Ribosomal protein L14 [50193] (1 family) (S)
    automatically mapped to Pfam PF00238
  5. 2058000Family b.39.1.1: Ribosomal protein L14 [50194] (1 protein)
  6. 2058001Protein Ribosomal protein L14 [50195] (5 species)
  7. 2058084Species Thermus thermophilus [TaxId:274] [141308] (13 PDB entries)
    Uniprot Q5SHP8 1-122
  8. 2058093Domain d1vsai1: 1vsa I:1-122 [144522]
    Other proteins in same PDB: d1vsaa1, d1vsab1, d1vsac1, d1vsaf1, d1vsaf2, d1vsah1, d1vsaj1, d1vsal1, d1vsam1, d1vsao1, d1vsap1, d1vsaq1, d1vsar1, d1vsas1, d1vsat1, d1vsau1, d1vsaw1, d1vsax1, d1vsaz1
    protein/RNA complex
    protein/RNA complex

Details for d1vsai1

PDB Entry: 1vsa (more details), 3.71 Å

PDB Description: Crystal Structure of a 70S Ribosome-tRNA Complex Reveals Functional Interactions and Rearrangements. This file, 1VSA, contains the 50S ribosome subunit. 30S ribosome subunit is in the file 2OW8
PDB Compounds: (I:) 50S ribosomal protein L14

SCOPe Domain Sequences for d1vsai1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vsai1 b.39.1.1 (I:1-122) Ribosomal protein L14 {Thermus thermophilus [TaxId: 274]}
miqpqtylevadntgarkimcirvlkgsnakyatvgdvivasvkeaiprgavkegdvvka
vvvrtkkevkrpdgsairfddnaaviinnqleprgtrvfgpvarelrekgfmkivslape
vl

SCOPe Domain Coordinates for d1vsai1:

Click to download the PDB-style file with coordinates for d1vsai1.
(The format of our PDB-style files is described here.)

Timeline for d1vsai1: